arrow-down-2arrow-downbagbreadcrumbs-arrowbutton_arrowbutton_arrow_close_modal_windowdownloademailfacebook-footerfacebookgoogleplus-footergoogleplusgoogleplus_oldhomelinklinkedin-footerlinkedinlistmagnifymailmarkerpage-nav-arrow--rightpage-nav-news-arrow--leftpage-nav-news-arrow--rightpage-nav_gridpage-nav_leftpage-nav_rightpinterestshield-checkslider-arrow--leftarrow-dxtwitter-footertwitteruserworldmapyoutube-footer

Besuchen Sie Uteco auf der Print4All!

10.04.2018

In Halle 18 – Stand E02 / G01 präsentiert Uteco Group zwei neue Maschinen „Live on Show“: 

•    GAIA - Die EB-Version ist die neueste Ausführung der bereits auf der Labelexpo Europe 2017 erstmals gezeigten hybriden Schmalbahn-Inkjet-Digitaldruckmaschine. 
•    Rainbow 4.0 – Diese lösemittelfreie Kaschieranlage ist ausgelegt für alle Auflagenhöhen und ausgestattet mit einem effektiven System zur Bahnspannungskontrolle sämtlicher für die Herstellung von Lebensmittelverpackungen geeigneter Substrate. 

Parallel zur Fachmesse Print4All findet vom 30.-31. Mai eine Open-House-Veranstaltung im Produktionswerk 2 sowie im Technologiezentrum ConverDrome statt. Besucher haben dort die Möglichkeit, das Uteco-Portfolio an Flexodruckmaschinen in den verschiedensten Fertigungsstufen, sowie bei der  Feineinstellung und im Druckbetrieb zu sehen. Darüber hinaus werden auch Tiefdruckmaschinen sowie Beschichtungs- und Kaschieranlagen gezeigt. 

Als besonderes Ereignis erleben die Besucher des Open House die Weltpremiere der hybriden, mit Continuous-Inkjet-Stream-Technologie (CIJ) ausgestatteten Verpackungsdruckmaschine Sapphire EVO . Die individuell konfigurierbare Maschine verarbeitet auch wasserbasierte Farben und ermöglicht daher den umweltverträglichen Betrieb. Die neue Tiefdruckmaschine NXS 300 ist ebenfalls für den Einsatz wasserbasierter Farben geeignet, deren aktuelle Version in Zusammenarbeit mit führenden Herstellern zu einer „Grünen Technologie“ weiterentwickelt wurde.

Top