arrow-down-2arrow-downbagbreadcrumbs-arrowbutton_arrowbutton_arrow_close_modal_windowdownloademailfacebook-footerfacebookgoogleplus-footergoogleplusgoogleplus_oldhomelinklinkedin-footerlinkedinlistmagnifymailmarkerpage-nav-arrow--rightpage-nav-news-arrow--leftpage-nav-news-arrow--rightpage-nav_gridpage-nav_leftpage-nav_rightpinterestshield-checkslider-arrow--leftarrow-dxtwitter-footertwitteruserworldmapyoutube-footer

Kiss&go® - Touch&Go®: an innovative system for automatic setup

15.04.2016

One year after the official presentation of the “kiss & go®” system,Uteco is proud to announce the success of 33 systems sold and the full satisfaction of customers owning the 18 already in production. Initially developed on the ONYX model, the system is now available on the full CI Flexo product line including theTopaz, Diamond, and the newest Crystal models. The extensive testing of the system with different production materials makes the final product fully compatible with any type of substrate, or plate material. The accuracy achieved by the automatic impression settings of the kiss & go® system make the processes fully automated without any additional operator input. The amount of web/material necessary for the automatic impression setting by “ Kiss & Go” is approximately 140 meters, and can be as low as 40 meters depending on certain production criteria, making it the most efficient such system on the market. The system functionality is broken down into two distinct phases:


TOUCH & GO®
This patented automatic system establishes the first and lightest contact point between plate/anilox and plate/CI. The procedure, once selected, initiates automatically once the press is put in run condition and proceeds to advance the printing decks until the appropriate contact torque is measured taking into consideration the possible variables of sleeves, carriers, plates, etc... as well as multiple mechanical and temperature compensations. The “touch & go®” system in essence performs the lightest mechanical “touch” impression which will serve as the base reference and startingpoint for ”kiss & go®”.


KISS & GO®
Kiss & Go® is a patented system that performs the optical scan of 100% of the printed web and automatically sets the optimal printing impressions. The system performs an actual reading of the printed.surface much like the operator’s eye, but then it makes use of a mathematical algorithm establish the correct printing impression settings. The optical scanner is a contrast sensor which registers with extreme accuracy and sensitivity the quantity of ink deposited on the substrate independently of the printed subject. The system consists of an extremely compact scanning unit mounted between the last printing deck and the drying tunnel, and a main processing unit. The latter analyzes the data received by the scanning unit and in a few revolutions of the print cylinders calculates and performs the optimal settings by acting on the positioning systems of the plate and anilox cylinders. This function is fully automated in order toavoid external inputs which they may compromise the process.The mathematical algorithm which replaces the operator's subjective assessment eleminates unkown variables such as operator experience, and makes the  impression setting process extremely accurate and repetitive.

Top