arrow-down-2arrow-downbagbreadcrumbs-arrowbutton_arrowbutton_arrow_close_modal_windowdownloademailfacebook-footerfacebookgoogleplus-footergoogleplusgoogleplus_oldhomelinklinkedin-footerlinkedinlistmagnifymailmarkerpage-nav-arrow--rightpage-nav-news-arrow--leftpage-nav-news-arrow--rightpage-nav_gridpage-nav_leftpage-nav_rightpinterestshield-checkslider-arrow--leftarrow-dxtwitter-footertwitteruserworldmapyoutube-footer

Silver SIL

The roto off-set printing press SILVER SIL stands out for the high printing quality, reduced costs of printing plates, wastes reduction, run’s high quality standard, accurate color reproductibility, wide application range, easy use.

VERSATILE PRINTING
The SILVER SIL processes the most different printing materials such as paper, paper board, flexible films and alluminium.

The SILVER SIL convinces thanks to following advantages: easy operation, shaftless tecnology, productivity, fast make ready, flexible and modular unit system.

Additional units:

• Unwind/rewind duplex automatic
• Insetting
• Register control
• Die-cutter
• Sheeter
• Remote ink control
• Blanket washing system
• Web video system
• UV curing system
• Flexo unit
• Screen printing unit
• Rotogravure unit
• Hot foil stamping unit
• Laminating unit
• Delamination unit
• Corona treater
• Cooling unit on Uv curing
• Hot air dryer for water/solvent based

Technical characteristics Silver SIL

SILVER SIL

Web Width

mm

520

Print Width

mm

500

Range Repeat Lengths

mm

407 / 720

Mechanical Speed

m/min

300 (opt. 400)

Material Range (*)

µm

14 up to 300

(*) depending on substrate

Top