arrow-down-2arrow-downbagbreadcrumbs-arrowbutton_arrowbutton_arrow_close_modal_windowdownloademailfacebook-footerfacebookgoogleplus-footergoogleplusgoogleplus_oldhomelinklinkedin-footerlinkedinlistmagnifymailmarkerpage-nav-arrow--rightpage-nav-news-arrow--leftpage-nav-news-arrow--rightpage-nav_gridpage-nav_leftpage-nav_rightpinterestshield-checkslider-arrow--leftarrow-dxtwitter-footertwitteruserworldmapyoutube-footer

Onyx XS EcoOne

FOUR PROCESSES:

1. Printing EB
2. Coating
3. Laminating
4. Slitting

ADVANTAGES:

A few key characteristics of electron beam curing include the following:
• High speed curing, up to 400 m/min
• Relatively “cold” process (ΔT ~ 5-10°C)
• Curing is less affected by color or print density
• Cure inhibited by oxygen, nitrogen atmosphere required
• Cure in nitrogen atmosphere reduces odor chances
• Wet-on-wet printing with single curing unit at end of press
• No photoinitiators
• Lower energy consumption
• Low beat (IR) radiation on substrate
• Low maintenance means less down time

THERMILOX

The patented Thermilox® system is applicable to EB and UV flexo presses in order to guarantee the accurate and continuous control of ink temperature during the print run.

SPRINTWASH

The ONYX XS is equipped with an automatic and modular washing system designed by Uteco.

EB ADVANCED TECHNOLOGY

Gravure-like quality

• Higher resolution and tone values
• 50% less dot gain with smooth vignettes
• Highest Phyical properties (gloss & resistance)

Lowest total print cost

• 25% less energy Consumption
• 60% less color ink laydown
• Reduce waste

Green platform ink

• 100% reduction in solvent emissions
• 60% reduction in ink consumption
• Less regulatory and insurance cost

Safe for food

• FDA compliant
• Low odor taint and extractable levels
• Safe for operator to handle

Technical characteristics Onyx XS EcoOne

Model

 

ONYX XS ECO ONE

Max material width

mm

650 ÷ 1050

Max printing width

mm

620 ÷ 1020

Min. printing repeat

mm

240 ÷ 310

Max printing repeat

mm

650

Mechanical speed m/min 300
Tension range daN 2 ÷ 40
Inks   water / solvent based, UV/EB
Reels diameter mm 800 ÷1.000
Top